Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Psychromonas ingrahamii ATP synthase subunit b (atpF)

This Recombinant Psychromonas ingrahamii ATP synthase subunit b (atpF) spans the amino acid sequence from region 1-156.

Product Specifications

Product Name Alternative

ATP synthase subunit b, ATP synthase F (0) sector subunit b, ATPase subunit I, F-type ATPase subunit b, F-ATPase subunit b

UniProt

A1T0Z3

Expression Region

1-156

Origin

Psychromonas ingrahamii (strain 37)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MNINATLLGQAIAFAVFVWFCMKYVWPPLLAAIEDRQKKISDGLTQAERAGKDLELAQAK ASEKLKEAKVQAAEIIEQANKRRNQIVEAAKTEAETERQKIIAQGEAEVEVDRNRVREEL RLKVSALAIAGAEKIIKRSIDKEANSDIIDKLVAEL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-FGF8 antibody
STJ23656 100 µl

Anti-FGF8 antibody

Sign In for Pricing
View Details
Olr1406 Protein Vector (Rat) (pPB-C-His)
PV288062 500 ng

Olr1406 Protein Vector (Rat) (pPB-C-His)

Sign In for Pricing
View Details
TBC1D22A Antibody
CSB-PA023196GA01HU 100 µL

TBC1D22A Antibody

Sign In for Pricing
View Details
Rat IL-3 ELISA Kit
CEK1726 96 Tests

Rat IL-3 ELISA Kit

Sign In for Pricing
View Details
OLFML2B Protein Lysate (Mouse) with C-HA Tag
32500034 100 µg

OLFML2B Protein Lysate (Mouse) with C-HA Tag

Sign In for Pricing
View Details
Human DPP10 ELISA Kit
ELA-E0498h 96 Tests

Human DPP10 ELISA Kit

Sign In for Pricing
View Details