Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Bacillus subtilis Uncharacterized membrane protein yuiD (yuiD)

This Recombinant Bacillus subtilis Uncharacterized membrane protein yuiD (yuiD) spans the amino acid sequence from region 1-158.

Product Specifications

Product Name Alternative

Uncharacterized membrane protein yuiD

UniProt

O32107

Expression Region

1-158

Origin

Bacillus subtilis (strain 168)

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MELLTNFPLLSSLAAIIFAQVIKVPIQFIVSRKLDWSLVTSTGGMPSSHSAAVTALSTGV ALEHGLDSSLFAVSAIFAVITMFDATGVRRHAGEQATVINKLVIDFNRFVNEAKDFPKAA EKEKQKKLKELLGHQPIEVFFGGLTGILLTLVLAYFFM

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

KLF13 polyclonal antibody
BZ16055-01 50 µL

KLF13 polyclonal antibody

Sign In for Pricing
View Details
KLF13 polyclonal antibody
BZ16055-02 100 µL

KLF13 polyclonal antibody

Sign In for Pricing
View Details
OVA (323-339)
orb3053942-01 25 mg

OVA (323-339)

Sign In for Pricing
View Details
OVA (323-339)
orb3053942-02 50 mg

OVA (323-339)

Sign In for Pricing
View Details
OVA (323-339)
orb3053942-03 100 mg

OVA (323-339)

Sign In for Pricing
View Details
OVA (323-339)
orb3053942-04 5 mg

OVA (323-339)

Sign In for Pricing
View Details