Recombinant Helianthus annuus Putative ATP synthase protein YMF19 (YMF19)
This Recombinant Helianthus annuus Putative ATP synthase protein YMF19 (YMF19) spans the amino acid sequence from region 1-159.
Product Specifications
Product Name Alternative
Putative ATP synthase protein YMF19, EC= 3.6.3.14, Mitochondrial protein YMF19
UniProt
P41248
Expression Region
1-159
Origin
Helianthus annuus (Common sunflower)
Field of Research
Metabolism Research
Form
Lyophilized powder
Storage Conditions
Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week
Notes
For research use only.
Preservative
Tris/PBS-based buffer, 6% Trehalose, pH 8.0
AA Sequence
MPQLDKFTYFTQFFWSCLFLFTFYIAICNDGDGLLGISRILKLRNQLLSHRTNNIRSKDP NSLEDILRKGFSTGLSYMYSSLFEDSQWCKAVDLLGKRRKITLISCFGEISGSRGMERNI FYLISKSSYSTSSNPGWGITCRNDIMLIHVPHGQGSIGF
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BNC470017-100 1x 100 µL
Ep-CAM / CD326 (VU-1D9), CF647 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC880009-100 1x 100 µL
MART-1 / Melan-A (M2-7C10), CF488A conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC401003-500 1x 500 µL
Mucin 5AC (MUC5AC) (58M1), CF640R conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC941543-500 1x 500 µL
Calnexin (Endoplasmic Reticulum Marker) (CANX/1543), CF594 conjugate, 0.1mg/mL
Sign In for Pricing
View Details