Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Prochlorococcus marinus Cytochrome b6-f complex subunit 4 (petD)

This Recombinant Prochlorococcus marinus Cytochrome b6-f complex subunit 4 (petD) spans the amino acid sequence from region 1-160.

Product Specifications

Product Name Alternative

Cytochrome b6-f complex subunit 4, 17 kDa polypeptide

UniProt

A2CBQ9

Expression Region

1-160

Origin

Prochlorococcus marinus (strain MIT 9303)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MHILKKPDFSDPKLRAKLAKGMGHNYYGEPAWPNDLLYIFPVVILGTFACLVGLAVLDPA MLGDKADPFATPLEILPEWYLYPVFQILRVVPNKLLGIVLQTLVPLGLMLIPFIENVNKY QNPFRRPIAMAFFLFGTMITIYLGIGACLPIDKSLTLGLF

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

LSS siRNA (Human)
MBS8211020-01 15 nmol

LSS siRNA (Human)

Sign In for Pricing
View Details
LSS siRNA (Human)
MBS8211020-02 30 nmol

LSS siRNA (Human)

Sign In for Pricing
View Details
LSS siRNA (Human)
MBS8211020-03 5x 30 nmol

LSS siRNA (Human)

Sign In for Pricing
View Details
TRPV4 Polyclonal Antibody
JOT-AP09238-01 20 µL

TRPV4 Polyclonal Antibody

Sign In for Pricing
View Details
TRPV4 Polyclonal Antibody
JOT-AP09238-02 50 μL

TRPV4 Polyclonal Antibody

Sign In for Pricing
View Details
TRPV4 Polyclonal Antibody
JOT-AP09238-03 100 µL

TRPV4 Polyclonal Antibody

Sign In for Pricing
View Details