Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Danio rerio Protein cornichon homolog 2 (cnih2)

This Recombinant Danio rerio Protein cornichon homolog 2 (cnih2) spans the amino acid sequence from region 1-160.

Product Specifications

Product Name Alternative

Protein cornichon homolog 2

UniProt

Q5BL21

Expression Region

1-160

Origin

Danio rerio (Zebrafish) (Brachydanio rerio)

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MAFTFAAFCYMLTLVLCAALIFFVIWQIIAFDELRTDFKNPIDQSNPTRARERILNIERI CNLLRRLVVPEYSIHGLFCLMFMCAGEWVTLGLNIPLLLYHLWRFFHRPADGSEVMYDPV SVMNADILNYCQKESWCKLGFYLLSFFYYLYSMVYALVSF

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD31 / PECAM-1 (158-2B3), CF488A conjugate, 0.1mg/mL
BNC880352-500 1x 500 µL

CD31 / PECAM-1 (158-2B3), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD8 (C8/1035), CF568 conjugate, 0.1mg/mL
BNC681035-500 1x 500 µL

CD8 (C8/1035), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Human IgG Immunoglobulin (IG266), CF405S conjugate, 0.1mg/mL
BNC040266-500 1x 500 µL

Human IgG Immunoglobulin (IG266), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
P53 Tumor Suppressor Protein (PAb240), CF647 conjugate, 0.1mg/mL
BNC471634-100 1x 100 µL

P53 Tumor Suppressor Protein (PAb240), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
EGFR (Epidermal Growth Factor Receptor) (GFR/2968R), CF488A conjugate, 0.1mg/mL
BNC882968-100 1x 100 µL

EGFR (Epidermal Growth Factor Receptor) (GFR/2968R), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD45RA (PTPRC/1131), CF488A conjugate, 0.1mg/mL
BNC881131-500 1x 500 µL

CD45RA (PTPRC/1131), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details