Recombinant Rhizobium sp. Uncharacterized protein y4jG (NGR_a03080)
This Recombinant Rhizobium sp. Uncharacterized protein y4jG (NGR_a03080) spans the amino acid sequence from region 1-162.
Product Specifications
Product Name Alternative
Uncharacterized protein y4jG
UniProt
P55507
Expression Region
1-162
Origin
Rhizobium sp. (strain NGR234)
Form
Lyophilized powder
Storage Conditions
Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week
Notes
For research use only.
Preservative
Tris/PBS-based buffer, 6% Trehalose, pH 8.0
AA Sequence
MSALEDVRTVALPRDCVSTVQAHLRSVGQQGHEGMALWVGVQQDQHFVIAETVIPAQRHI RTSDGVCVMVPAEELHRLNVWLYKRGLTLLAQIHSHPGRAYHSTTDDAYAVATTIGCLSL VVPNFAREPFDFAHVAAYRLDAKANWNEVPSAVLTRMITITS
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BNC400204-500 1x 500 µL
Complement C4d (C4D204), CF640R conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC941081-500 1x 500 µL
CD45RO (190-2F2.5), CF594 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC040178-100 1x 100 µL
CD50 (ICAM-3) (186-2G9), CF405S conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC470017-100 1x 100 µL
Ep-CAM / CD326 (VU-1D9), CF647 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC880096-100 1x 100 µL
Histone H1 (AE-4), CF488A conjugate, 0.1mg/mL
Sign In for Pricing
View Details