Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant ATP synthase subunit b (atpF)

This Recombinant ATP synthase subunit b (atpF) spans the amino acid sequence from region 1-162.

Product Specifications

Product Name Alternative

ATP synthase subunit b, ATP synthase F (0) sector subunit b, ATPase subunit I, F-type ATPase subunit b, F-ATPase subunit b

UniProt

P41014

Expression Region

1-162

Origin

Bacillus caldotenax

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MLWKANVWVLGEAAHGISGGTIIYQLLMFIILLALLRKFAWQPLMNIMKQREEHIANEID QAEKRRQEAEKLLEEQRELMKQSRQDDEALIENARKLAQEQKEQIVASARGQAERVKEAA KKEIEREKEQAMAALREQVASLSVVIASKVIEKELTEQDPAS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Calpastatin (CAST/1550), CF405S conjugate, 0.1mg/mL
BNC041550-100 1x 100 µL

Calpastatin (CAST/1550), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Colloidal Gold Conjugated Sheep Affinity Purified Antibody to Mouse IgG1,  40nm
GM-300-40 1 mL

Colloidal Gold Conjugated Sheep Affinity Purified Antibody to Mouse IgG1, 40nm

Sign In for Pricing
View Details
Cerkl Mouse Gene Knockout Kit (CRISPR)
KN503180 1 Kit

Cerkl Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
2-Bromoisophthaldehyde
TRC-B685885-25G 25 g

2-Bromoisophthaldehyde

Sign In for Pricing
View Details
GOT2 Recombinant Rabbit Monoclonal Antibody [JE54-46]
ET7110-71 100 µL

GOT2 Recombinant Rabbit Monoclonal Antibody [JE54-46]

Sign In for Pricing
View Details
(1R)-(-)-10-Camphorsulfonyl Chloride
TRC-C175070-2G 2 g

(1R)-(-)-10-Camphorsulfonyl Chloride

Sign In for Pricing
View Details