Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Cyanidioschyzon merolae Photosystem I assembly protein Ycf4 (ycf4)

This Recombinant Cyanidioschyzon merolae Photosystem I assembly protein Ycf4 (ycf4) spans the amino acid sequence from region 1-164.

Product Specifications

Product Name Alternative

Photosystem I assembly protein Ycf4

UniProt

Q85FQ1

Expression Region

1-164

Origin

Cyanidioschyzon merolae (Red alga)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSIQRESIIGSRRWSNMIWCAILVTAGSGFWFNGMQSELALQGAIMCFYGSVAVTLSVYL FLTIWWDVGGGYNEYDTENKSITIWRRGFGNKTIFLKYTRDQMQALKVVVKDGLNPKREI YLCTTTGAQIPLTAVGEPMPLAELEQKATQLAQWLNLSLVGMRA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD45 / LCA (2B11 + PD7/26), CF594 conjugate, 0.1mg/mL
BNC940745-500 1x 500 µL

CD45 / LCA (2B11 + PD7/26), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD16 (C16/1045), CF640R conjugate, 0.1mg/mL
BNC401045-100 1x 100 µL

CD16 (C16/1045), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
TNF alpha (J2D10), CF740 conjugate, 0.1mg/mL
BNC740994-100 1x 100 µL

TNF alpha (J2D10), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD63 (LAMP3/968), CF740 conjugate, 0.1mg/mL
BNC740968-100 1x 100 µL

CD63 (LAMP3/968), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
TPO (Thyroid Peroxidase) (Thyroid Marker) (TPO/1922), CF594 conjugate, 0.1mg/mL
BNC941922-100 1x 100 µL

TPO (Thyroid Peroxidase) (Thyroid Marker) (TPO/1922), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD14 (Monocyte / Macrophage Marker) (LPSR/2408), CF568 conjugate, 0.1mg/mL
BNC682408-100 1x 100 µL

CD14 (Monocyte / Macrophage Marker) (LPSR/2408), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details