Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Streptococcus suis ATP synthase subunit b (atpF)

This Recombinant Streptococcus suis ATP synthase subunit b (atpF) spans the amino acid sequence from region 1-168.

Product Specifications

Product Name Alternative

ATP synthase subunit b, ATP synthase F (0) sector subunit b, ATPase subunit I, F-type ATPase subunit b, F-ATPase subunit b

UniProt

A4VVK3

Expression Region

1-168

Origin

Streptococcus suis (strain 05ZYH33)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MATTITMQSSTILGNFILVTASFAVLIILIRVFAWDKITGIFEERANKIANDIDAAEEKL TAAANLVQQREDELVQGRIESQKIIQDAVERAKLEKKRILEQADVEIQGLKQKAQLEIEA EKREAQENLRVQVAELAVDLASKIILEDLDQQAHSNLIDRYLDKLGDK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Tinurilimab Biosimilar - Research Grade
ICH5042-20mg 20 mg

Tinurilimab Biosimilar - Research Grade

Sign In for Pricing
View Details
Beta-D-Fructopyranose 1-Sulfamate (Mixture of Isomers)
TRC-F792495-2.5MG 2.5 mg

Beta-D-Fructopyranose 1-Sulfamate (Mixture of Isomers)

Sign In for Pricing
View Details
alpha-Terpineol glucoside-d6
TRC-T452641-10MG 10 mg

alpha-Terpineol glucoside-d6

Sign In for Pricing
View Details
Collagen IX (COL9A1) (NM_001851) Human Over-expression Lysate
LY419709 100 µg

Collagen IX (COL9A1) (NM_001851) Human Over-expression Lysate

Sign In for Pricing
View Details
2,4-Dihydroxybenzaldehyde
TRC-D450995-1G 1 g

2,4-Dihydroxybenzaldehyde

Sign In for Pricing
View Details
N-(2-Chlorobenzyl)-2-(1H-indol-3-yl)ethanamine
TRC-A622490-50MG 50 mg

N-(2-Chlorobenzyl)-2-(1H-indol-3-yl)ethanamine

Sign In for Pricing
View Details