Recombinant Streptococcus suis ATP synthase subunit b (atpF)
This Recombinant Streptococcus suis ATP synthase subunit b (atpF) spans the amino acid sequence from region 1-168.
Product Specifications
Product Name Alternative
ATP synthase subunit b, ATP synthase F (0) sector subunit b, ATPase subunit I, F-type ATPase subunit b, F-ATPase subunit b
UniProt
A4VVK3
Expression Region
1-168
Origin
Streptococcus suis (strain 05ZYH33)
Field of Research
Metabolism Research
Form
Lyophilized powder
Storage Conditions
Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week
Notes
For research use only.
Preservative
Tris/PBS-based buffer, 6% Trehalose, pH 8.0
AA Sequence
MATTITMQSSTILGNFILVTASFAVLIILIRVFAWDKITGIFEERANKIANDIDAAEEKL TAAANLVQQREDELVQGRIESQKIIQDAVERAKLEKKRILEQADVEIQGLKQKAQLEIEA EKREAQENLRVQVAELAVDLASKIILEDLDQQAHSNLIDRYLDKLGDK
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
TP310583M 100 µg
SKAR (POLDIP3) (NM_032311) Human Recombinant Protein
Sign In for Pricing
View Details 
TA397984 1 mg
Rabbit IgG (H&L) Antibody Biotin Conjugated Pre-Adsorbed
Sign In for Pricing
View Details 
GA113223 1 Kit
Human Coiled Coil Domain Containing Protein 3 (CCDC3) activation kit by CRISPRa
Sign In for Pricing
View Details 