Recombinant Mycobacterium sp. ATP synthase subunit b (atpF)
This Recombinant Mycobacterium sp. ATP synthase subunit b (atpF) spans the amino acid sequence from region 1-169.
Product Specifications
Product Name Alternative
ATP synthase subunit b, ATP synthase F (0) sector subunit b, ATPase subunit I, F-type ATPase subunit b, F-ATPase subunit b
UniProt
Q1B549
Expression Region
1-169
Origin
Mycobacterium sp. (strain MCS)
Field of Research
Metabolism Research
Form
Lyophilized powder
Storage Conditions
Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week
Notes
For research use only.
Preservative
Tris/PBS-based buffer, 6% Trehalose, pH 8.0
AA Sequence
MGDLSTTILAAEEGGGGNFLVPNGTFFFVLLIFLIVLGVIAKWVVPPISKVLQEREAMVT KTVEDNRKAADLFAAAQGDSQQVMAKARREASGIRDEARGEGRKILEDMRSRASAESAAT LQKTNEELSRQGQQTAAELQSSIETLSATLASRVLGVDISSAAATSQGR
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
T9679-01 1 mg
N- (3-cyano-4,5,6,7-tetrahydro-1-benzothiophen-2-yl) pyrazine-2-carboxamide
Sign In for Pricing
View Details T9679-02 1 mL - 10 mM (in DMSO)
N- (3-cyano-4,5,6,7-tetrahydro-1-benzothiophen-2-yl) pyrazine-2-carboxamide
Sign In for Pricing
View Details T9679-03 5 mg
N- (3-cyano-4,5,6,7-tetrahydro-1-benzothiophen-2-yl) pyrazine-2-carboxamide
Sign In for Pricing
View Details T9679-04 10 mg
N- (3-cyano-4,5,6,7-tetrahydro-1-benzothiophen-2-yl) pyrazine-2-carboxamide
Sign In for Pricing
View Details T9679-05 25 mg
N- (3-cyano-4,5,6,7-tetrahydro-1-benzothiophen-2-yl) pyrazine-2-carboxamide
Sign In for Pricing
View Details