Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mycobacterium sp. ATP synthase subunit b (atpF)

This Recombinant Mycobacterium sp. ATP synthase subunit b (atpF) spans the amino acid sequence from region 1-169.

Product Specifications

Product Name Alternative

ATP synthase subunit b, ATP synthase F (0) sector subunit b, ATPase subunit I, F-type ATPase subunit b, F-ATPase subunit b

UniProt

Q1B549

Expression Region

1-169

Origin

Mycobacterium sp. (strain MCS)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MGDLSTTILAAEEGGGGNFLVPNGTFFFVLLIFLIVLGVIAKWVVPPISKVLQEREAMVT KTVEDNRKAADLFAAAQGDSQQVMAKARREASGIRDEARGEGRKILEDMRSRASAESAAT LQKTNEELSRQGQQTAAELQSSIETLSATLASRVLGVDISSAAATSQGR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Methyl Tetracosanoate
OR1013880-01 100 mg

Methyl Tetracosanoate

Sign In for Pricing
View Details
Methyl Tetracosanoate
OR1013880-02 250 mg

Methyl Tetracosanoate

Sign In for Pricing
View Details
Methyl Tetracosanoate
OR1013880-03 1 g

Methyl Tetracosanoate

Sign In for Pricing
View Details
Methyl Tetracosanoate
OR1013880-04 5 g

Methyl Tetracosanoate

Sign In for Pricing
View Details
Methyl Tetracosanoate
OR1013880-05 25 g

Methyl Tetracosanoate

Sign In for Pricing
View Details
ELISA Kit For Pro-neuropeptide Y
E0879p 96 Tests

ELISA Kit For Pro-neuropeptide Y

Sign In for Pricing
View Details