Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Clostridium botulinum UPF0316 protein CLI_0673 (CLI_0673)

This Recombinant Clostridium botulinum UPF0316 protein CLI_0673 (CLI_0673) spans the amino acid sequence from region 1-170.

Product Specifications

Product Name Alternative

UPF0316 protein CLI_0673

UniProt

A7GAZ7

Expression Region

1-170

Origin

Clostridium botulinum (strain Langeland / NCTC 10281 / Type F)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MLSYYAFIFFAKIMEVALMTIRTVLITRGEKLYGSIIGFIEVTIWLYVTSSVLSGIKDDP IRMVVYALGFTCGNYMGCVIEEKLAIGLLTINVITSESDGKRLAEILRDENVGVTMVDAE GKIEQKKMLIIHAKRKRREEIIRTIEGSDINAMISVNDIKTVYGGYGIRK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Ornidazole Isomer (Impurity)
TRC-O688505-250MG 250 mg

Ornidazole Isomer (Impurity)

Sign In for Pricing
View Details
RBPMS Rabbit Polyclonal Antibody
ER1901-43 100 µL

RBPMS Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
BMP6 Polyclonal Antibody
E-AB-13093-01 20 µL

BMP6 Polyclonal Antibody

Sign In for Pricing
View Details
BMP6 Polyclonal Antibody
E-AB-13093-02 60 µL

BMP6 Polyclonal Antibody

Sign In for Pricing
View Details
BMP6 Polyclonal Antibody
E-AB-13093-03 120 µL

BMP6 Polyclonal Antibody

Sign In for Pricing
View Details
BMP6 Polyclonal Antibody
E-AB-13093-04 200 µL

BMP6 Polyclonal Antibody

Sign In for Pricing
View Details