Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Clostridium botulinum UPF0316 protein CLI_0673 (CLI_0673)

This Recombinant Clostridium botulinum UPF0316 protein CLI_0673 (CLI_0673) spans the amino acid sequence from region 1-170.

Product Specifications

Product Name Alternative

UPF0316 protein CLI_0673

UniProt

A7GAZ7

Expression Region

1-170

Origin

Clostridium botulinum (strain Langeland / NCTC 10281 / Type F)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MLSYYAFIFFAKIMEVALMTIRTVLITRGEKLYGSIIGFIEVTIWLYVTSSVLSGIKDDP IRMVVYALGFTCGNYMGCVIEEKLAIGLLTINVITSESDGKRLAEILRDENVGVTMVDAE GKIEQKKMLIIHAKRKRREEIIRTIEGSDINAMISVNDIKTVYGGYGIRK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Ep-CAM / CD326 (EGP40/1120), CF488A conjugate, 0.1mg/mL
BNC881120-500 1x 500 µL

Ep-CAM / CD326 (EGP40/1120), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Blender Bag, 400ml x 60µm, 300 x 180mm, pack of 500 (10 pack fo 50)
IPD4400-B400 1 Each

Blender Bag, 400ml x 60µm, 300 x 180mm, pack of 500 (10 pack fo 50)

Sign In for Pricing
View Details
SPSB4 (NM_080862) Human Recombinant Protein
TP303566 20 µg

SPSB4 (NM_080862) Human Recombinant Protein

Sign In for Pricing
View Details
Frozen Tissue Sections, Kidney
CS517231 5x 5 µm

Frozen Tissue Sections, Kidney

Sign In for Pricing
View Details
Desmoglein-2 Antibody
KC-27642-01 50 μL

Desmoglein-2 Antibody

Sign In for Pricing
View Details
Desmoglein-2 Antibody
KC-27642-02 100 µL

Desmoglein-2 Antibody

Sign In for Pricing
View Details