Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Clostridium botulinum UPF0316 protein CLI_0673 (CLI_0673)

This Recombinant Clostridium botulinum UPF0316 protein CLI_0673 (CLI_0673) spans the amino acid sequence from region 1-170.

Product Specifications

Product Name Alternative

UPF0316 protein CLI_0673

UniProt

A7GAZ7

Expression Region

1-170

Origin

Clostridium botulinum (strain Langeland / NCTC 10281 / Type F)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MLSYYAFIFFAKIMEVALMTIRTVLITRGEKLYGSIIGFIEVTIWLYVTSSVLSGIKDDP IRMVVYALGFTCGNYMGCVIEEKLAIGLLTINVITSESDGKRLAEILRDENVGVTMVDAE GKIEQKKMLIIHAKRKRREEIIRTIEGSDINAMISVNDIKTVYGGYGIRK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Prom1 Mouse Gene Knockout Kit (CRISPR)
KN513953 1 Kit

Prom1 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Psoralen-PEG3-Biotin
39050-AAT 1 mg

Psoralen-PEG3-Biotin

Sign In for Pricing
View Details
Human DCDC1 activation kit by CRISPRa
GA117506 1 Kit

Human DCDC1 activation kit by CRISPRa

Sign In for Pricing
View Details
BRCA1 (Ab-1423) Antibody
8B7030-AAT 50 µg

BRCA1 (Ab-1423) Antibody

Sign In for Pricing
View Details
Azi2 Mouse Gene Knockout Kit (CRISPR)
KN501901 1 Kit

Azi2 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
S100P binding protein (S100PBP) Human Gene Knockout Kit (CRISPR)
KN402353 1 Kit

S100P binding protein (S100PBP) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details