Recombinant Prochlorococcus marinus ATP synthase subunit b (atpF)
This Recombinant Prochlorococcus marinus ATP synthase subunit b (atpF) spans the amino acid sequence from region 1-170.
Product Specifications
Product Name Alternative
ATP synthase subunit b, ATP synthase F (0) sector subunit b, ATPase subunit I, F-type ATPase subunit b, F-ATPase subunit b
UniProt
A3PEU1
Expression Region
1-170
Origin
Prochlorococcus marinus (strain MIT 9301)
Field of Research
Metabolism Research
Form
Lyophilized powder
Storage Conditions
Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week
Notes
For research use only.
Preservative
Tris/PBS-based buffer, 6% Trehalose, pH 8.0
AA Sequence
MNLTLFATEGFGLNFNLFETNILNWAVVVFGLYKFLPGFLGKMLQKRREGILLELKDAED RLLNATQALEKAKKDLSSAEEKASQIKADSLKRSESIRMESEKKAIEEMARIKQSAISDE SSEASRAISQLRKEAVELAIKKALDSLPNRLDKTTQENLVTQSINNIEVN
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
F4741 96 Tests
Nuclear Receptor subfamily 2 group C member 1 (NR2C1) Human ELISA Kit
Sign In for Pricing
View Details orb1344846 100 µg
Hexokinase Type III (HK3) Human Over-expression Lysate
Sign In for Pricing
View Details