Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Archaeoglobus fulgidus Uncharacterized protein AF_0762 (AF_0762)

This Recombinant Archaeoglobus fulgidus Uncharacterized protein AF_0762 (AF_0762) spans the amino acid sequence from region 1-171.

Product Specifications

Product Name Alternative

Uncharacterized protein AF_0762

UniProt

O29496

Expression Region

1-171

Origin

Archaeoglobus fulgidus (strain ATCC 49558 / VC-16 / DSM 4304 / JCM 9628 / NBRC 100126)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MCLQIGGGGMDLRGQTFTLEGVAASLLILLAVYTIFQSTVVIAPSWSDYANVQLKQLGYD ILRVFDSDGGNSSLKGAIVNCSSGFKAPDEFNANLSKILDSLNAFGKVELIWVNGSKIES HALYGFNKTPTPDAVRVSRFVVVQDLNNSECFNLTTPTTKVVEVRLTLWRT

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD6 (Negative Marker of T-regulatory Cells) (C6/2884R), CF740 conjugate, 0.1mg/mL
BNC742884-100 1x 100 µL

CD6 (Negative Marker of T-regulatory Cells) (C6/2884R), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
BEGAIN Human Gene Knockout Kit (CRISPR)
KN400943 1 Kit

BEGAIN Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
1700012A03Rik (NM_029587) Mouse Tagged ORF Clone
MG200737 10 µg

1700012A03Rik (NM_029587) Mouse Tagged ORF Clone

Sign In for Pricing
View Details
Recombinant Histone H3 (mono methyl K4) Antibody
RC-15018-01 50 μL

Recombinant Histone H3 (mono methyl K4) Antibody

Sign In for Pricing
View Details
Recombinant Histone H3 (mono methyl K4) Antibody
RC-15018-02 100 µL

Recombinant Histone H3 (mono methyl K4) Antibody

Sign In for Pricing
View Details
Recombinant Histone H3 (mono methyl K4) Antibody
RC-15018-03 1 mL

Recombinant Histone H3 (mono methyl K4) Antibody

Sign In for Pricing
View Details