Recombinant Frog virus 3 Uncharacterized protein 043R (FV3-043R)
This Recombinant Frog virus 3 Uncharacterized protein 043R (FV3-043R) spans the amino acid sequence from region 1-171.
Product Specifications
Product Name Alternative
Uncharacterized protein 043R
UniProt
Q6GZT3
Expression Region
1-171
Origin
Frog virus 3 (isolate Goorha) (FV-3)
Field of Research
Infectious Disease & Virology
Form
Lyophilized powder
Storage Conditions
Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week
Notes
For research use only.
Preservative
Tris/PBS-based buffer, 6% Trehalose, pH 8.0
AA Sequence
MEEVDGCAGPNSEAGALTAGALTAGAFAVTAGAGVAGAGVAGVGWCSWCSWCSWCWCSWC SWCWCSWCWCSWCWCSWCWCSWCWCSWCWCSWCWCSWCLSKGWEDRGGLEGCKSCKGWCL CSHCWCWCSWCWCSWCSWCLSKGWEDRGGLEGCKSCKGWCLCSHCRCWSIN
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BNC050017-500 1x 500 µL
Ep-CAM / CD326 (VU-1D9), CF405M conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC470096-500 1x 500 µL
Histone H1 (AE-4), CF647 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC680218-100 1x 100 µL
CD100 (Semaphorin-4D) (A8), CF568 conjugate, 0.1mg/mL
Sign In for Pricing
View Details