Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant ATP synthase subunit b (atpF)

This Recombinant ATP synthase subunit b (atpF) spans the amino acid sequence from region 1-171.

Product Specifications

Product Name Alternative

ATP synthase subunit b, ATP synthase F (0) sector subunit b, ATPase subunit I, F-type ATPase subunit b, F-ATPase subunit b

UniProt

P63656

Expression Region

1-171

Origin

Mycobacterium tuberculosis

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MGEVSAIVLAASQAAEEGGESSNFLIPNGTFFVVLAIFLVVLAVIGTFVVPPILKVLRER DAMVAKTLADNKKSDEQFAAAQADYDEAMTEARVQASSLRDNARADGRKVIEDARVRAEQ QVASTLQTAHEQLKRERDAVELDLRAHVGTMSATLASRILGVDLTASAATR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MTF1 Rabbit Polyclonal Antibody (Fluoro550)
orb3105073 100 µg

MTF1 Rabbit Polyclonal Antibody (Fluoro550)

Sign In for Pricing
View Details
Lentiviral mouse Map4k4 shRNA (UAS) - Lentiviral mouse Map4k4 shRNA (UAS, GFP) (100)
GTR15246069 1 Vial

Lentiviral mouse Map4k4 shRNA (UAS) - Lentiviral mouse Map4k4 shRNA (UAS, GFP) (100)

Sign In for Pricing
View Details
ZBTB48 Rabbit Polyclonal Antibody (Fluoro594)
orb3094028 100 µg

ZBTB48 Rabbit Polyclonal Antibody (Fluoro594)

Sign In for Pricing
View Details
Pyrrolidinedithiocarbamate ammonium
orb573364-01 100 mg

Pyrrolidinedithiocarbamate ammonium

Sign In for Pricing
View Details
Pyrrolidinedithiocarbamate ammonium
orb573364-02 250 mg

Pyrrolidinedithiocarbamate ammonium

Sign In for Pricing
View Details
Pyrrolidinedithiocarbamate ammonium
orb573364-03 1 g

Pyrrolidinedithiocarbamate ammonium

Sign In for Pricing
View Details