Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Bacillus licheniformis ATP synthase subunit b (atpF)

This Recombinant Bacillus licheniformis ATP synthase subunit b (atpF) spans the amino acid sequence from region 1-172.

Product Specifications

Product Name Alternative

ATP synthase subunit b, ATP synthase F (0) sector subunit b, ATPase subunit I, F-type ATPase subunit b, F-ATPase subunit b

UniProt

Q65DX0

Expression Region

1-172

Origin

Bacillus licheniformis (strain DSM 13 / ATCC 14580)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSFLPQVMGAGVGFNAGTMLFQLVAMLILLALLKKYALGPLLNIMKEREDYITGEISSAE KKNEEAKKLIEEQQALLKEAREESQSLIENAKKLGEQQKDEIIKAARQEAERMKESARSE IVKERDQAVTALREQVASLSVMIASKVIEKELDEQAQEKLIQDYLKEVGESR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

3,5-Diiodo-4-hydroxy-DL-phenyllactic Acid
TRC-D455083-50MG 50 mg

3,5-Diiodo-4-hydroxy-DL-phenyllactic Acid

Sign In for Pricing
View Details
Recombinant EGFR (phospho Y1086) Antibody
RC-16349-01 50 μL

Recombinant EGFR (phospho Y1086) Antibody

Sign In for Pricing
View Details
Recombinant EGFR (phospho Y1086) Antibody
RC-16349-02 100 µL

Recombinant EGFR (phospho Y1086) Antibody

Sign In for Pricing
View Details
Recombinant EGFR (phospho Y1086) Antibody
RC-16349-03 1 mL

Recombinant EGFR (phospho Y1086) Antibody

Sign In for Pricing
View Details
Ethyl fluoroacetate
TRC-E678740-5G 5 g

Ethyl fluoroacetate

Sign In for Pricing
View Details
Glypican-3 (1G12), CF594 conjugate, 0.1mg/mL
BNC940862-500 1x 500 µL

Glypican-3 (1G12), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details