Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Bacillus licheniformis ATP synthase subunit b (atpF)

This Recombinant Bacillus licheniformis ATP synthase subunit b (atpF) spans the amino acid sequence from region 1-172.

Product Specifications

Product Name Alternative

ATP synthase subunit b, ATP synthase F (0) sector subunit b, ATPase subunit I, F-type ATPase subunit b, F-ATPase subunit b

UniProt

Q65DX0

Expression Region

1-172

Origin

Bacillus licheniformis (strain DSM 13 / ATCC 14580)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSFLPQVMGAGVGFNAGTMLFQLVAMLILLALLKKYALGPLLNIMKEREDYITGEISSAE KKNEEAKKLIEEQQALLKEAREESQSLIENAKKLGEQQKDEIIKAARQEAERMKESARSE IVKERDQAVTALREQVASLSVMIASKVIEKELDEQAQEKLIQDYLKEVGESR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Triglyme-d6
TRC-T793802-10MG 10 mg

Triglyme-d6

Sign In for Pricing
View Details
Tylvalosin-d9
TRC-T898212-2.5MG 2.5 mg

Tylvalosin-d9

Sign In for Pricing
View Details
FOXB1 (NM_012182) Human Recombinant Protein
TP314562 20 µg

FOXB1 (NM_012182) Human Recombinant Protein

Sign In for Pricing
View Details
Rb (RB1) (C-term) Rabbit Polyclonal Antibody
AP18176PU-N 400 µL

Rb (RB1) (C-term) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Magnetic Stirrer BMGS-201
BMGS-201 1 Unit

Magnetic Stirrer BMGS-201

Sign In for Pricing
View Details
Tissue FFPE Sections, Prostate
CS703813 5x 5 µm

Tissue FFPE Sections, Prostate

Sign In for Pricing
View Details