Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Prochlorococcus marinus Cytochrome b6-f complex iron-sulfur subunit (petC)

This Recombinant Prochlorococcus marinus Cytochrome b6-f complex iron-sulfur subunit (petC) spans the amino acid sequence from region 1-178.

Product Specifications

Product Name Alternative

Cytochrome b6-f complex iron-sulfur subunit, EC= 1.10.9.1, Plastohydroquinone:plastocyanin oxidoreductase iron-sulfur protein, ISP, RISP, Rieske iron-sulfur protein

UniProt

A3PBI5

Expression Region

1-178

Origin

Prochlorococcus marinus (strain MIT 9301)

Field of Research

Pharmacology & Drug Discovery

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MTQLSSNDVPSMGRRQFMNLLTFGTATGVALGALYPVANYFMPLRAGGGGGGTSAKDELG NPITKTGWLATHQAGDRSLVQGLKGDPTYLIVNEVGEIGEFGLNAICTHLGCVVPWDSGA NKFICPCHGSQYDTNGKVVRGPAPLSLALAHVDIEDDAVLVKQWSETDFRTNENPWWA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant ASFV EP84R Protein, N-His
AP93645 50 µg

Recombinant ASFV EP84R Protein, N-His

Sign In for Pricing
View Details
RWDD1 Double Nickase Plasmid (h2)
sc-412196-NIC-2 20 µg

RWDD1 Double Nickase Plasmid (h2)

Sign In for Pricing
View Details
SH-PTP2 Polyclonal Antibody
MBS9245210-01 0.1 mL

SH-PTP2 Polyclonal Antibody

Sign In for Pricing
View Details
SH-PTP2 Polyclonal Antibody
MBS9245210-02 5x 0.1 mL

SH-PTP2 Polyclonal Antibody

Sign In for Pricing
View Details
RNASE4 siRNA Oligos set (Human)
40202171 3x 5 nmol

RNASE4 siRNA Oligos set (Human)

Sign In for Pricing
View Details
AK5 discontinued
385593 200 µL

AK5 discontinued

Sign In for Pricing
View Details