Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant ATP synthase subunit b, chloroplastic (atpF)

This Recombinant ATP synthase subunit b, chloroplastic (atpF) spans the amino acid sequence from region 1-178.

Product Specifications

Product Name Alternative

ATP synthase subunit b, chloroplastic, ATP synthase F (0) sector subunit b, ATPase subunit I

UniProt

Q40609

Expression Region

1-178

Origin

Ochrosphaera neapolitana

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MHLFTQTLVRFSSLIADGGVSFNPDIFETNVVNLAILTGGIFYLGSNALSESLVERQQKI LGAIQEAEERLEQATERLKESKTQLEQAQLVIASIKEDAETTAKQVKSAILTEGKNEIER LTSAAKSQIVTIEAQVRKQISDYVVSLALQRVTLQLEGKLSDAAQQQILDRNISKLKD

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse CXCL3/DCIP-1 Affinity Purified Polyclonal Ab
AF5568-SP 25 µg

Mouse CXCL3/DCIP-1 Affinity Purified Polyclonal Ab

Sign In for Pricing
View Details
Fam65b ORF Vector (Mouse) (pORF)
ORF044512 1.0 µg DNA

Fam65b ORF Vector (Mouse) (pORF)

Sign In for Pricing
View Details
Map2 Antibody
orb522949-01 50 μL

Map2 Antibody

Sign In for Pricing
View Details
Map2 Antibody
orb522949-02 100 µL

Map2 Antibody

Sign In for Pricing
View Details
CAMK2B antibody
orb254697-01 50 μL

CAMK2B antibody

Sign In for Pricing
View Details
CAMK2B antibody
orb254697-02 100 µL

CAMK2B antibody

Sign In for Pricing
View Details