Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Prochlorococcus marinus Cytochrome b6-f complex iron-sulfur subunit (petC)

This Recombinant Prochlorococcus marinus Cytochrome b6-f complex iron-sulfur subunit (petC) spans the amino acid sequence from region 1-178.

Product Specifications

Product Name Alternative

Cytochrome b6-f complex iron-sulfur subunit, EC= 1.10.9.1, Plastohydroquinone:plastocyanin oxidoreductase iron-sulfur protein, ISP, RISP, Rieske iron-sulfur protein

UniProt

Q7VDC0

Expression Region

1-178

Origin

Prochlorococcus marinus (strain SARG / CCMP1375 / SS120)

Field of Research

Pharmacology & Drug Discovery

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MTQMSPSDVPSMGRRQFMNLLTFGTATGVALGALYPVANFFMPLRAGGGTGGTTAKDELG NAVTATGWLSNHPAGDRSLVQGLKGDPTYLIVDGDAAIGNFGINAICTHLGCVVPWNSGA NKYICPCHGSQYDANGKVVRGPAPLSLALTHIDIDDDNVLVSQWTETDFRTGDKPWWA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TRITC Conjugated Phytolacca americana Lectin (Pokeweed) -PWMPWA-
R-1901-2 2 mg

TRITC Conjugated Phytolacca americana Lectin (Pokeweed) -PWMPWA-

Sign In for Pricing
View Details
BAAT Polyclonal Antibody
E-AB-14782-01 20 µL

BAAT Polyclonal Antibody

Sign In for Pricing
View Details
BAAT Polyclonal Antibody
E-AB-14782-02 60 µL

BAAT Polyclonal Antibody

Sign In for Pricing
View Details
BAAT Polyclonal Antibody
E-AB-14782-03 120 µL

BAAT Polyclonal Antibody

Sign In for Pricing
View Details
BAAT Polyclonal Antibody
E-AB-14782-04 200 µL

BAAT Polyclonal Antibody

Sign In for Pricing
View Details
Frozen Tissue Sections, Prostate
CS511034 5x 5 µm

Frozen Tissue Sections, Prostate

Sign In for Pricing
View Details