Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Bovine TM2 domain-containing protein 2 (TM2D2)

This Recombinant Bovine TM2 domain-containing protein 2 (TM2D2) spans the amino acid sequence from region 36-214.

Product Specifications

Product Name Alternative

TM2 domain-containing protein 2

UniProt

Q2TA35

Expression Region

36-214

Origin

Bos taurus (Bovine)

Field of Research

Musculoskeletal & Connective Tissue Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

HNATAEPELTSAGAAHPEGSPGAASWEYGDPHSPVILCSYLPDEFIECEDPVDHVGNTTA FQELGYGCLKFGGQAYRDVEHTRVQCRALDGIECASPRTFLRENKPCIKYTGHYFITTLL YSFFLGCFGVDRFCLGHTGTAVGKLLTLGGLGIWWFVDLILLITGGLMPSDGSNWCTIY

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Fischeria A
HY-133209 1 Each

Fischeria A

Sign In for Pricing
View Details
FEM1B Blocking Peptide (C-Term)
MBS9230676-01 0.5 mg

FEM1B Blocking Peptide (C-Term)

Sign In for Pricing
View Details
FEM1B Blocking Peptide (C-Term)
MBS9230676-02 5x 0.5 mg

FEM1B Blocking Peptide (C-Term)

Sign In for Pricing
View Details
Anti-EPHB4 Polyclonal Antibody
TMAB-05624-01 50 μL

Anti-EPHB4 Polyclonal Antibody

Sign In for Pricing
View Details
Anti-EPHB4 Polyclonal Antibody
TMAB-05624-02 100 µL

Anti-EPHB4 Polyclonal Antibody

Sign In for Pricing
View Details
Anti-EPHB4 Polyclonal Antibody
TMAB-05624-03 200 µL

Anti-EPHB4 Polyclonal Antibody

Sign In for Pricing
View Details