Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Thermosynechococcus elongatus Cytochrome b6-f complex iron-sulfur subunit (petC)

This Recombinant Thermosynechococcus elongatus Cytochrome b6-f complex iron-sulfur subunit (petC) spans the amino acid sequence from region 1-180.

Product Specifications

Product Name Alternative

Cytochrome b6-f complex iron-sulfur subunit, EC= 1.10.9.1, Plastohydroquinone:plastocyanin oxidoreductase iron-sulfur protein, ISP, RISP, Rieske iron-sulfur protein

UniProt

P0C8N8

Expression Region

1-180

Origin

Thermosynechococcus elongatus (strain BP-1)

Field of Research

Pharmacology & Drug Discovery

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MAQVSGMSDVPDMGRRQFMNLLTFGTITGTALGALYPVVKYFIPPASGGTGGGAVAKDAL GNDIKVSEYLAKHLPGDRSLAQGIKGDPTYVIVTEDHQIANYGLNAVCTHLGCVVPWNVS ENKFICPCHGSQYDSTGKVVRGPAPLSLALVKATVTEDDKLVFTPWTEIDFRTGKEPWWT

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD7 (T3-3A1), CF647 conjugate, 0.1mg/mL
BNC470978-500 1x 500 µL

CD7 (T3-3A1), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD47 (B6H12.2), CF568 conjugate, 0.1mg/mL
BNC680437-100 1x 100 µL

CD47 (B6H12.2), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD3e (CRIS-7), CF568 conjugate, 0.1mg/mL
BNC681050-100 1x 100 µL

CD3e (CRIS-7), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD11c (HC1/1), CF568 conjugate, 0.1mg/mL
BNC680152-100 1x 100 µL

CD11c (HC1/1), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details