Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Silicibacter sp. ATP synthase subunit b/b' (atpG)

This Recombinant Silicibacter sp. ATP synthase subunit b/b' (atpG) spans the amino acid sequence from region 1-181.

Product Specifications

Product Name Alternative

ATP synthase subunit b/b', ATP synthase F (0) sector subunit b/b', ATPase subunit II, F-type ATPase subunit b/b', F-ATPase subunit b/b'

UniProt

Q1GDE2

Expression Region

1-181

Origin

Silicibacter sp. (strain TM1040)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MATTTHDAGHGAAEAAHGSSGMPQLDFSTYGNQIFWLLVTLVVIYLILSRIALPRIAAIL NERQGTITNDLAAAEDLKAKAVEAENAYNKALADARAEAQRIAAETRAEIQAEVDEAIAK ADAEISAKAAESEKAIAEIRAGALESVKVVAADTASALVAALGGKDDADAVKAAVAERTE G

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Bovine Probable G-Protein Coupled Receptor 34 (GPR34) ELISA Kit
MBS9913834-01 48 Well

Bovine Probable G-Protein Coupled Receptor 34 (GPR34) ELISA Kit

Sign In for Pricing
View Details
Bovine Probable G-Protein Coupled Receptor 34 (GPR34) ELISA Kit
MBS9913834-02 96 Well

Bovine Probable G-Protein Coupled Receptor 34 (GPR34) ELISA Kit

Sign In for Pricing
View Details
Bovine Probable G-Protein Coupled Receptor 34 (GPR34) ELISA Kit
MBS9913834-03 5x 96 Well

Bovine Probable G-Protein Coupled Receptor 34 (GPR34) ELISA Kit

Sign In for Pricing
View Details
Bovine Probable G-Protein Coupled Receptor 34 (GPR34) ELISA Kit
MBS9913834-04 10x 96 Well

Bovine Probable G-Protein Coupled Receptor 34 (GPR34) ELISA Kit

Sign In for Pricing
View Details
LCE1C (NM_178351) Human Untagged Clone
SC307165 10 µg

LCE1C (NM_178351) Human Untagged Clone

Sign In for Pricing
View Details
Recombinant Drosophila melanogaster Putative odorant receptor 74a (Or74a), partial
MBS7102834 Inquire

Recombinant Drosophila melanogaster Putative odorant receptor 74a (Or74a), partial

Sign In for Pricing
View Details