Recombinant Danio rerio Mitochondrial inner membrane protease subunit 2 (immp2l)
This Recombinant Danio rerio Mitochondrial inner membrane protease subunit 2 (immp2l) spans the amino acid sequence from region 1-183.
Product Specifications
Product Name Alternative
Mitochondrial inner membrane protease subunit 2, EC= 3.4.21.-, IMP2-like protein
UniProt
Q6AZD4
Expression Region
1-183
Origin
Danio rerio (Zebrafish) (Brachydanio rerio)
Field of Research
Cell Biology
Form
Lyophilized powder
Storage Conditions
Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week
Notes
For research use only.
Preservative
Tris/PBS-based buffer, 6% Trehalose, pH 8.0
AA Sequence
MAQTGFGRRYFKAFVSGFFVAVPVTVTVLDRLAYVARVEGASMQPSLNPDGESSPDVVLL NRWSVRNYHVQRGDIVSVLSPKNPQQKIIKRVIGIEGDFIKTLGYKNRYVRVPDGHLWIE GDHHGHSFDSNAFGPVSLGLVHGRASHIIWPPSRWQRIEPSVPPDRRPLLNWDRAAEDKY DDD
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BNC470012-500 1x 500 µL
Tyrosinase (T311), CF647 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC040391-500 1x 500 µL
CD81 / TAPA-1 (1.3.3.22), CF405S conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC402324-500 1x 500 µL
Neurofilament (NF-H) (Neuronal Marker) (NEFL.H/2324R), CF640R conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC741227-500 1x 500 µL
Thyroglobulin (TGB04 + TGB05), CF740 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 