Recombinant Populus trichocarpa ATP synthase subunit b, chloroplastic (atpF)
This Recombinant Populus trichocarpa ATP synthase subunit b, chloroplastic (atpF) spans the amino acid sequence from region 1-184.
Product Specifications
Product Name Alternative
ATP synthase subunit b, chloroplastic, ATP synthase F (0) sector subunit b, ATPase subunit I
UniProt
A4GYP4
Expression Region
1-184
Origin
Populus trichocarpa (Western balsam poplar) (Populus balsamifera subsp. trichocarpa)
Field of Research
Metabolism Research
Form
Lyophilized powder
Storage Conditions
Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week
Notes
For research use only.
Preservative
Tris/PBS-based buffer, 6% Trehalose, pH 8.0
AA Sequence
MKNITDSFVSLGHWSSAGSFGFNTDILATNPINLSVVLGVLIFFGKGVLSDLLDNRKQRI LNTIRNSEELRGGAIEQLEKARARLRKVEIEADQFRVNGYSEIEREKLNLINSTYKTLEQ LENYKNETIHFEQQRAINQVRQRVFQQALQGALGTLNSCLTNELHLRTISANIGMFGAMK EITN
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
49534154 3x 1.0 µg DNA
Vmn1r117 CRISPR All-in-one AAV vector set (with saCas9)(Mouse)
Sign In for Pricing
View Details 
130325-PE 100 µL
NFATC2IP (Nuclear Factor Of Activated T-Cells, Cytoplasmic, Calcineurin-Dependent 2 Interacting Protein, FLJ14639, MGC126790, MGC138387) (PE)
Sign In for Pricing
View Details 
abx027196-01 80 µL
BH3 Interacting Domain Death Agonist (BID) Antibody
Sign In for Pricing
View Details abx027196-02 400 µL
BH3 Interacting Domain Death Agonist (BID) Antibody
Sign In for Pricing
View Details 