Recombinant Populus trichocarpa ATP synthase subunit b, chloroplastic (atpF)
This Recombinant Populus trichocarpa ATP synthase subunit b, chloroplastic (atpF) spans the amino acid sequence from region 1-184.
Product Specifications
Product Name Alternative
ATP synthase subunit b, chloroplastic, ATP synthase F (0) sector subunit b, ATPase subunit I
UniProt
A4GYP4
Expression Region
1-184
Origin
Populus trichocarpa (Western balsam poplar) (Populus balsamifera subsp. trichocarpa)
Field of Research
Metabolism Research
Form
Lyophilized powder
Storage Conditions
Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week
Notes
For research use only.
Preservative
Tris/PBS-based buffer, 6% Trehalose, pH 8.0
AA Sequence
MKNITDSFVSLGHWSSAGSFGFNTDILATNPINLSVVLGVLIFFGKGVLSDLLDNRKQRI LNTIRNSEELRGGAIEQLEKARARLRKVEIEADQFRVNGYSEIEREKLNLINSTYKTLEQ LENYKNETIHFEQQRAINQVRQRVFQQALQGALGTLNSCLTNELHLRTISANIGMFGAMK EITN
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
25435151 3x 1.0 µg DNA
KCNV1 CRISPR All-in-one AAV vector set (with saCas9)(Human)
Sign In for Pricing
View Details 
297407-01 5 mg
Methyl 4,6-O-benzylidene-3-O- (b-D-glucopyranoside) -a-D-glucopyranoside
Sign In for Pricing
View Details 297407-02 10 mg
Methyl 4,6-O-benzylidene-3-O- (b-D-glucopyranoside) -a-D-glucopyranoside
Sign In for Pricing
View Details 297407-03 25 mg
Methyl 4,6-O-benzylidene-3-O- (b-D-glucopyranoside) -a-D-glucopyranoside
Sign In for Pricing
View Details