Recombinant Cyanothece sp. ATP synthase subunit b 2 (atpF2)
This Recombinant Cyanothece sp. ATP synthase subunit b 2 (atpF2) spans the amino acid sequence from region 1-184.
Product Specifications
Product Name Alternative
ATP synthase subunit b 2, ATP synthase F (0) sector subunit b 2, ATPase subunit I 2, F-type ATPase subunit b 2, F-ATPase subunit b 2
UniProt
B1WUI0
Expression Region
1-184
Origin
Cyanothece sp. (strain ATCC 51142)
Field of Research
Metabolism Research
Form
Lyophilized powder
Storage Conditions
Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week
Notes
For research use only.
Preservative
Tris/PBS-based buffer, 6% Trehalose, pH 8.0
AA Sequence
MTSITGMIDPFLLLATESHAEGEALIGFHFDFLESNILNLAILVGVLVFYGRKVVGNILS ERRNQIAQAIQEAEEKQRTAAQALAKEKENLAQAQKEAARIHEAAIERAKTLRAEIAAQS ERDIARLKETAAADLSSEQERVMAQLKKQIAEQAIVKAESQLKAQVDNNTQQRLIDRSIA RLGG
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
MBS7096308 Inquire
Recombinant Human Signal peptide peptidase-like 3 (SPPL3), partial
Sign In for Pricing
View Details 
MBS9337350-01 48 Well
Rat Phosphatidylinositol-4, 5-bisphosphate 3-kinase catalytic subunit beta isoform (PIK3CB) ELISA Kit
Sign In for Pricing
View Details MBS9337350-02 96 Well
Rat Phosphatidylinositol-4, 5-bisphosphate 3-kinase catalytic subunit beta isoform (PIK3CB) ELISA Kit
Sign In for Pricing
View Details MBS9337350-03 5x 96 Well
Rat Phosphatidylinositol-4, 5-bisphosphate 3-kinase catalytic subunit beta isoform (PIK3CB) ELISA Kit
Sign In for Pricing
View Details MBS9337350-04 10x 96 Well
Rat Phosphatidylinositol-4, 5-bisphosphate 3-kinase catalytic subunit beta isoform (PIK3CB) ELISA Kit
Sign In for Pricing
View Details