Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Eucalyptus globulus subsp. globulus Photosystem I assembly protein Ycf4 (ycf4)

This Recombinant Eucalyptus globulus subsp. globulus Photosystem I assembly protein Ycf4 (ycf4) spans the amino acid sequence from region 1-184.

Product Specifications

Product Name Alternative

Photosystem I assembly protein Ycf4

UniProt

Q49KY7

Expression Region

1-184

Origin

Eucalyptus globulus subsp. globulus (Tasmanian blue gum)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSCRSEHIWIELIVGSRKISNFCWAFILFLGSLGFVLVGSSSYLGKNLISLVPSQQILFF PQGIVMSFYGIAGLFISSYLWCTISWNVGSGYDRFDRKEGIVCIFRWGFPGKNRRIFLRF RMKDIQSIRIEVKEGISARRVLYMEIKGQGAVPLTRTDENLTPREIEQKAAELAYFLRVP IEVF

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

rno-miR-6318 miRNA Antagomir
MBS8321130-01 10 nmol

rno-miR-6318 miRNA Antagomir

Sign In for Pricing
View Details
rno-miR-6318 miRNA Antagomir
MBS8321130-02 20 nmol

rno-miR-6318 miRNA Antagomir

Sign In for Pricing
View Details
rno-miR-6318 miRNA Antagomir
MBS8321130-03 5x 20 nmol

rno-miR-6318 miRNA Antagomir

Sign In for Pricing
View Details
PCMV-SMARCA5-3xHA-Neo Plasmid
PVT68831 2 µg

PCMV-SMARCA5-3xHA-Neo Plasmid

Sign In for Pricing
View Details
DIA-250-YL AB Labels
049343 Box of 14100 Label(s)

DIA-250-YL AB Labels

Sign In for Pricing
View Details
Recombinant Ajellomyces capsulata Tethering factor for nuclear proteasome STS1 (STS1)
MBS1074693-01 0.05 mg (E-Coli)

Recombinant Ajellomyces capsulata Tethering factor for nuclear proteasome STS1 (STS1)

Sign In for Pricing
View Details