Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Anthoceros formosae ATP synthase subunit b, chloroplastic (atpF)

This Recombinant Anthoceros formosae ATP synthase subunit b, chloroplastic (atpF) spans the amino acid sequence from region 1-184.

Product Specifications

Product Name Alternative

ATP synthase subunit b, chloroplastic, ATP synthase F (0) sector subunit b, ATPase subunit I

UniProt

Q85AL8

Expression Region

1-184

Origin

Anthoceros formosae (Hornwort)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MRNLIFFVIPFHFWLPAEGFKLNTNLLETNLINLGVVLGLLVYFGKGVLNNLLDKRKQTI LSTIRDAEERYKEATDKLKQAQIRLQQAELKANEIRVNGLSEMEKEKQDLINIADEDSKR LEDSKNATIRFEEQRAIEQVRQQVSRLALERASEVLNNCLNSELHSRMIDYHIGLLKTMG STTE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD19 (CVID3/155), CF740 conjugate, 0.1mg/mL
BNC740155-500 1x 500 µL

CD19 (CVID3/155), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CGK2 (PRKG2) Human Gene Knockout Kit (CRISPR)
KN415879 1 Kit

CGK2 (PRKG2) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Recombinant Mouse CD45/PTPRC (C-6His)
PKSM041443-01 10 µg

Recombinant Mouse CD45/PTPRC (C-6His)

Sign In for Pricing
View Details
Recombinant Mouse CD45/PTPRC (C-6His)
PKSM041443-02 50 µg

Recombinant Mouse CD45/PTPRC (C-6His)

Sign In for Pricing
View Details
Tissue FFPE Sections, Prostate
CS703938 5x 5 µm

Tissue FFPE Sections, Prostate

Sign In for Pricing
View Details
S100B (4C4.9 + S100B/1012), 0.2mg/mL
BNC401204-500 1x 500 µL

S100B (4C4.9 + S100B/1012), 0.2mg/mL

Sign In for Pricing
View Details