Recombinant Aquifex aeolicus ATP synthase subunit b (atpF)
This Recombinant Aquifex aeolicus ATP synthase subunit b (atpF) spans the amino acid sequence from region 1-185.
Product Specifications
Product Name Alternative
ATP synthase subunit b, ATP synthase F (0) sector subunit b, ATPase subunit I, F-type ATPase subunit b, F-ATPase subunit b
UniProt
O67526
Expression Region
1-185
Origin
Aquifex aeolicus (strain VF5)
Field of Research
Metabolism Research
Form
Lyophilized powder
Storage Conditions
Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week
Notes
For research use only.
Preservative
Tris/PBS-based buffer, 6% Trehalose, pH 8.0
AA Sequence
MVRLISFLTLASTFAYAGEGHLGHSPGALIWKGLNILAFLGIVYYFGKKPISEAFNKFYN SIVESLVNAEREFMMAREELSKAKEELENAKKKAQEYEKLAIETAETEKKKILQHAQEVS ERIKEKAKETIEIELNKAKKELALYGIQKAEEIAKDLLQKEFKKSKVQEKYIEAQLKLLE ERKNA
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BNC401045-500 1x 500 µL
CD16 (C16/1045), CF640R conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC040149-100 1x 100 µL
CD106 / VCAM1 (1.4C3), CF405S conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC402818-500 1x 500 µL
MUC1 / CA15-3 / EMA / CD227 (Epithelial Marker) (MUC1/2818R), CF640R conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC042651-100 1x 100 µL
Interleukin 10 (IL10) (Immunoregulation Marker) (IL10/2651R), CF405S conjugate, 0.1mg/mL
Sign In for Pricing
View Details