Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Equine herpesvirus 2 Uncharacterized gene E9 protein (E9)

This Recombinant Equine herpesvirus 2 Uncharacterized gene E9 protein (E9) spans the amino acid sequence from region 20-205.

Product Specifications

Product Name Alternative

Uncharacterized gene E9 protein

UniProt

Q66676

Expression Region

20-205

Origin

Equine herpesvirus 2 (strain 86/87) (EHV-2)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

SSTTSTTATSNGTTSTLNTTVSSVASTSTPSTESTTTTTPTTTNSSASSTSVTVASTATT SPQTNSTTSLTSPLSSTFSSTSANVSSSTTTTTSSTTKSTSSTKPKTSKNNPKTQEAGAE AAVMISLGILYLFILLLIIFVIILICFIRRRQHHQHGGGGGGQGGPMIPLDVISLESGLG ESWSSE

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Fibulin 5 Antibody
MBS850422-01 0.1 mg

Fibulin 5 Antibody

Sign In for Pricing
View Details
Fibulin 5 Antibody
MBS850422-02 0.1 mL (AF405L)

Fibulin 5 Antibody

Sign In for Pricing
View Details
Fibulin 5 Antibody
MBS850422-03 0.1 mL (AF405S)

Fibulin 5 Antibody

Sign In for Pricing
View Details
Fibulin 5 Antibody
MBS850422-04 0.1 mL (AF610)

Fibulin 5 Antibody

Sign In for Pricing
View Details
Fibulin 5 Antibody
MBS850422-05 0.1 mL (AF635)

Fibulin 5 Antibody

Sign In for Pricing
View Details
Fibulin 5 Antibody
MBS850422-06 0.1 mL (APC)

Fibulin 5 Antibody

Sign In for Pricing
View Details