Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Myc target protein 1 (Myct1)

This Recombinant Mouse Myc target protein 1 (Myct1) spans the amino acid sequence from region 1-188.

Product Specifications

Product Name Alternative

Myc target protein 1, Myc target in myeloid cells protein 1

UniProt

Q8R411

Expression Region

1-188

Origin

Mus musculus (Mouse)

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MANNTTSLGSPWPENFWEDLIMSFTVSVAIGLAIGGFLWALFVFLSRRRRASAPISQWSP TRRPRSSYNHGLNRTGFYRHSGYERRSNLSLASLTFQRQASMELVNSFPRKSSFRASTFH PFLQCPPLPVETESQLMTLSASTTPSTLSTAHSPSRPDFRWSSNSLRMGLSTPPPPAYES IIKAFPDS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

IL-4 / Interleukin 4 (IL4/1597), CF488A conjugate, 0.1mg/mL
BNC881597-500 1x 500 µL

IL-4 / Interleukin 4 (IL4/1597), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
ERK2 (MAPK1) Rabbit Polyclonal Antibody
TA392776 100 µL

ERK2 (MAPK1) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Sodium (3R,5R)-7-(2-(4-Chlorophenyl)-5-isopropyl-3-phenyl-4-(phenylcarbamoyl)-1H-pyrrol-1-yl)-3,5-dihydroxyheptanoate
TRC-S960223-1MG 1 mg

Sodium (3R,5R)-7-(2-(4-Chlorophenyl)-5-isopropyl-3-phenyl-4-(phenylcarbamoyl)-1H-pyrrol-1-yl)-3,5-dihydroxyheptanoate

Sign In for Pricing
View Details
MCL1 (Ab-159) Antibody
8B1097-AAT 50 µg

MCL1 (Ab-159) Antibody

Sign In for Pricing
View Details
CD1E (NM_030893) Human Over-expression Lysate
LY403088 100 µg

CD1E (NM_030893) Human Over-expression Lysate

Sign In for Pricing
View Details
Biotin Coated - 96 well plates - 8 Well Strips on 12 x 8 frame - White PS
MTW15F4-BIO 10x 96 Well Plates

Biotin Coated - 96 well plates - 8 Well Strips on 12 x 8 frame - White PS

Sign In for Pricing
View Details