Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Pig Transmembrane and coiled-coil domains protein 1 (TMCO1)

This Recombinant Pig Transmembrane and coiled-coil domains protein 1 (TMCO1) spans the amino acid sequence from region 1-188.

Product Specifications

Product Name Alternative

Transmembrane and coiled-coil domains protein 1

UniProt

C5HGF3

Expression Region

1-188

Origin

Sus scrofa (Pig)

Field of Research

Neuroscience; Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSTMFADTLLIVFISVCTALLAEGITWVLVYRTDKYKRLKAEVEKQSKKLEKKKETITES AGRQQKKKIERQEEKLKNNNRDLSMVRMKSMFAIGFCFTALMGMFNSIFDGRVVAKLPFT PLSYIQGLSHRNLLGDDTTDCSFIFLYILCTMSIRQNIQKILGLAPSRAATKQAGGFLGP PPPSGKFS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD16 (C16/1045), CF640R conjugate, 0.1mg/mL
BNC401045-500 1x 500 µL

CD16 (C16/1045), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Mucin 5AC (MUC5AC) (45M1), CF740 conjugate, 0.1mg/mL
BNC740031-500 1x 500 µL

Mucin 5AC (MUC5AC) (45M1), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
TAG-72 / CA72.4 (B72.3), CF640R conjugate, 0.1mg/mL
BNC400276-500 1x 500 µL

TAG-72 / CA72.4 (B72.3), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
P27 / KIP1 (SX53G8), CF740 conjugate, 0.1mg/mL
BNC740669-500 1x 500 µL

P27 / KIP1 (SX53G8), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Major Vault Protein (MVP) (1032), CF594 conjugate, 0.1mg/mL
BNC940225-100 1x 100 µL

Major Vault Protein (MVP) (1032), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD11c (HC1/1), CF680R conjugate, 0.1mg/mL
BNC810152-500 1x 500 µL

CD11c (HC1/1), CF680R conjugate, 0.1mg/mL

Sign In for Pricing
View Details