Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Pig Selenoprotein S (SELS)

This Recombinant Pig Selenoprotein S (SELS) spans the amino acid sequence from region 1-190.

Product Specifications

Product Name Alternative

Selenoprotein S, SelS

UniProt

F1SR90

Expression Region

1-190

Origin

Sus scrofa (Pig)

Field of Research

Neuroscience; Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MEQDGDQLSARPALETEGLRFLHVTVGSLLATYGWYIVFCCILLYVVFQKLSTRLRALRQ RHLDGAAAALEPDVVVKRQEALAAARLKMQEELNAQVEKHKEKLRQLEEEKRRQKIERWD SVQEGRSYRGDARKRQEEDSPGPSTSSVIPKRKSDKKPLRGGGYNPLSGEGGGACSWRPG RRGPSSGGUG

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD73 Rabbit Polyclonal Antibody
R1107-6 100 µL

CD73 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
BOB.1 (B-Cell Marker) (BOB1/2422), 1mg/mL
BNUM2422-50 1x 50 µL

BOB.1 (B-Cell Marker) (BOB1/2422), 1mg/mL

Sign In for Pricing
View Details
CFTR (Cystic Fibrosis Transmembrane Conductance Regulator) (rCFTR/1342), CF640R conjugate, 0.1mg/mL
BNC402291-100 1x 100 µL

CFTR (Cystic Fibrosis Transmembrane Conductance Regulator) (rCFTR/1342), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Fingolimod (FTY720 Hydrochloride)
SIH-523-5MG 5 mg

Fingolimod (FTY720 Hydrochloride)

Sign In for Pricing
View Details
Cinnamonitrile
TRC-C442010-5G 5 g

Cinnamonitrile

Sign In for Pricing
View Details
HDAC5 pSer498 Rabbit Polyclonal Antibody
AP02465PU-N 100 µL

HDAC5 pSer498 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details