Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Pig Selenoprotein S (SELS)

This Recombinant Pig Selenoprotein S (SELS) spans the amino acid sequence from region 1-190.

Product Specifications

Product Name Alternative

Selenoprotein S, SelS

UniProt

F1SR90

Expression Region

1-190

Origin

Sus scrofa (Pig)

Field of Research

Neuroscience; Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MEQDGDQLSARPALETEGLRFLHVTVGSLLATYGWYIVFCCILLYVVFQKLSTRLRALRQ RHLDGAAAALEPDVVVKRQEALAAARLKMQEELNAQVEKHKEKLRQLEEEKRRQKIERWD SVQEGRSYRGDARKRQEEDSPGPSTSSVIPKRKSDKKPLRGGGYNPLSGEGGGACSWRPG RRGPSSGGUG

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Serpinb3b Mouse Gene Knockout Kit (CRISPR)
KN515584 1 Kit

Serpinb3b Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
TOM1 antibody
FNab08855 100 µg

TOM1 antibody

Sign In for Pricing
View Details
Recombinant CD163 Antibody
RC-16799-01 50 μL

Recombinant CD163 Antibody

Sign In for Pricing
View Details
Recombinant CD163 Antibody
RC-16799-02 100 µL

Recombinant CD163 Antibody

Sign In for Pricing
View Details
Recombinant CD163 Antibody
RC-16799-03 1 mL

Recombinant CD163 Antibody

Sign In for Pricing
View Details
XFD568 NHS Ester
1823-AAT 1 mg

XFD568 NHS Ester

Sign In for Pricing
View Details