Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Prochlorococcus marinus Photosystem I assembly protein Ycf4 (ycf4)

This Recombinant Prochlorococcus marinus Photosystem I assembly protein Ycf4 (ycf4) spans the amino acid sequence from region 1-191.

Product Specifications

Product Name Alternative

Photosystem I assembly protein Ycf4

UniProt

A2C7Y6

Expression Region

1-191

Origin

Prochlorococcus marinus (strain MIT 9303)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSADLQETPKAGDASLERLEQSVLGFRRLSNQLLAVIVTIGGLGFTLTCLSSYLGRDLLP IGSPSSLLFVPQGLVMGLYGIAGLLLASYLWAMININLGAGSNNFDKASGMVKICRRGYF KLISAEFPLKDVKAVKVEVRDGFNPLRRLSLRVQGRRDITLTRVGQPLPLAQLEQDGAEL ARFLDVNLEGL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

EMP3 (NM_001425) Human Over-expression Lysate
LY400554 100 µg

EMP3 (NM_001425) Human Over-expression Lysate

Sign In for Pricing
View Details
ASMT (NM_001171038) Human Over-expression Lysate
LY432958 100 µg

ASMT (NM_001171038) Human Over-expression Lysate

Sign In for Pricing
View Details
KML-29
TRC-K648500-25MG 25 mg

KML-29

Sign In for Pricing
View Details
SOX9 / SRY-box 9 (rSOX9/2288), CF740 conjugate, 0.1mg/mL
BNC742288-100 1x 100 µL

SOX9 / SRY-box 9 (rSOX9/2288), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
SuLT2A1 (NM_003167) Human Recombinant Protein
TP304737L 1 mg

SuLT2A1 (NM_003167) Human Recombinant Protein

Sign In for Pricing
View Details
CDT2 (DTL) Human Gene Knockout Kit (CRISPR)
KN207280RB 1 Kit

CDT2 (DTL) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details