What is the catalog number for Recombinant Pongo abelii Protein RER1 (RER1)?

The catalog number for Recombinant Pongo abelii Protein RER1 (RER1) is orb2929524.

What sizes are available for Recombinant Pongo abelii Protein RER1 (RER1)?

Recombinant Pongo abelii Protein RER1 (RER1) is available in the following size(s): 20 µg, 100 µg.

How many pack sizes does Recombinant Pongo abelii Protein RER1 (RER1) come in?

Recombinant Pongo abelii Protein RER1 (RER1) is available in 2 different pack sizes.

Is Recombinant Pongo abelii Protein RER1 (RER1) in stock?

Recombinant Pongo abelii Protein RER1 (RER1) is currently made to order / not held in immediate stock. Contact us for lead time.

Recombinant Pongo abelii Protein RER1 (RER1)

This Recombinant Pongo abelii Protein RER1 (RER1) spans the amino acid sequence from region 1-196.

Product Specifications

Product Name Alternative

Protein RER1

UniProt

Q5R5U4

Expression Region

1-196

Origin

Pongo abelii (Sumatran orangutan)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSEGDSVGESVHGKPSVVYRFFTRLGQIYQSWLDKSTPYTAVRWVVTLGLSFVYMIRVYL LQGWYIVTYALGIYHLNLFIAFLSPKVDPSLMEDSDDGPSLPTKQNEEFRPFIRRLPEFK FWHAATKGILVAMVCTFFDAFNVPVFWPILVMYFIMLFCITMKRQIKHMIKYRYIPFTHG KRRYRGKEDAGKAFAS