Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Pongo abelii Protein RER1 (RER1)

This Recombinant Pongo abelii Protein RER1 (RER1) spans the amino acid sequence from region 1-196.

Product Specifications

Product Name Alternative

Protein RER1

UniProt

Q5R5U4

Expression Region

1-196

Origin

Pongo abelii (Sumatran orangutan)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSEGDSVGESVHGKPSVVYRFFTRLGQIYQSWLDKSTPYTAVRWVVTLGLSFVYMIRVYL LQGWYIVTYALGIYHLNLFIAFLSPKVDPSLMEDSDDGPSLPTKQNEEFRPFIRRLPEFK FWHAATKGILVAMVCTFFDAFNVPVFWPILVMYFIMLFCITMKRQIKHMIKYRYIPFTHG KRRYRGKEDAGKAFAS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Brs3 Pre-designed siRNA Set B
SI101566B 1 Each

Mouse Brs3 Pre-designed siRNA Set B

Sign In for Pricing
View Details
CC023 Antibody Blocking peptide
orb1443816 500 µg

CC023 Antibody Blocking peptide

Sign In for Pricing
View Details
Monkey TNR (Tenascin R) ELISA Kit
MBS2511860-01 24 Tests

Monkey TNR (Tenascin R) ELISA Kit

Sign In for Pricing
View Details
Monkey TNR (Tenascin R) ELISA Kit
MBS2511860-02 48 Tests

Monkey TNR (Tenascin R) ELISA Kit

Sign In for Pricing
View Details
Monkey TNR (Tenascin R) ELISA Kit
MBS2511860-03 96 Tests

Monkey TNR (Tenascin R) ELISA Kit

Sign In for Pricing
View Details
Monkey TNR (Tenascin R) ELISA Kit
MBS2511860-04 5x 96 Tests

Monkey TNR (Tenascin R) ELISA Kit

Sign In for Pricing
View Details