Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse High affinity copper uptake protein 1 (Slc31a1)

This Recombinant Mouse High affinity copper uptake protein 1 (Slc31a1) spans the amino acid sequence from region 1-196.

Product Specifications

Product Name Alternative

High affinity copper uptake protein 1, Copper transporter 1, CTR1, Solute carrier family 31 member 1

UniProt

Q8K211

Expression Region

1-196

Origin

Mus musculus (Mouse)

Field of Research

Neuroscience

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MNHMGMNHMEMHHHMGMNHTDDNITMPPHHHPTTSASHSHGGGDSMMMMPMTFYFDFKNV NLLFSGLVINTPGEMAGAFVAVFLLAMFYEGLKIAREGLLRKSQVSIRYNSMPVPGPNGT ILMETHKTVGQQMLSFPHLLQTVLHIIQVVISYFLMLIFMTYNGYLCIAVAAGAGTGYFL FSWKKAVVVDITEHCH

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Myristic Acid (D27, 98%)
TRC-M884625-10MG 10 mg

Myristic Acid (D27, 98%)

Sign In for Pricing
View Details
pOTB7-EEF1AKMT4 Plasmid
PVT13552 2 µg

pOTB7-EEF1AKMT4 Plasmid

Sign In for Pricing
View Details
MTA2 Rabbit Polyclonal Antibody (BF647)
orb2376350 100 µL

MTA2 Rabbit Polyclonal Antibody (BF647)

Sign In for Pricing
View Details
Aminoallyl-UTP-PEG5-AZDye555
JBS-NU-821-PEG5-AZ555 10 µL

Aminoallyl-UTP-PEG5-AZDye555

Sign In for Pricing
View Details
B30-260-7569-CLP2 Pre-sized Labels for Printers
121634 340 Roll (340 Label (s) x 1 Roll)

B30-260-7569-CLP2 Pre-sized Labels for Printers

Sign In for Pricing
View Details
PYROXD1 Peptide
orb1235258 0.1 mg

PYROXD1 Peptide

Sign In for Pricing
View Details