Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Photosystem I assembly protein Ycf4 (ycf4)

This Recombinant Photosystem I assembly protein Ycf4 (ycf4) spans the amino acid sequence from region 1-198.

Product Specifications

Product Name Alternative

Photosystem I assembly protein Ycf4

UniProt

P09362

Expression Region

1-198

Origin

Euglena gracilis

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MTLSKNENIKAKQKQINLPKILRQEIKENNKIIKWFYNIVMLLGGIGFLIVGISSYIGNN LIYFLDASEIIFFPQGITMCFYGTCGILFSINQISIILNGVGEGYNEFNKELNLMTIYRK GKQGKNSDINITYSLKDIEGIRIEIKNEYFNVKQNVFLRIKDKNDLPIIQLSNPIKISDL EKQASEIASFLNVPIKGY

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TMEM212 (NM_001164436) Human Over-expression Lysate
LC431152 20 µg

TMEM212 (NM_001164436) Human Over-expression Lysate

Sign In for Pricing
View Details
Fascin-1 (FSCN1/416), CF740 conjugate, 0.1mg/mL
BNC740416-100 1x 100 µL

Fascin-1 (FSCN1/416), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
PPM1L Antibody
8C18028-AAT 50 µg

PPM1L Antibody

Sign In for Pricing
View Details
B7-H4 (Immuno-Inhibitory Protein) (B7H4/1788), 1mg/mL
BNUM1788-50 1x 50 µL

B7-H4 (Immuno-Inhibitory Protein) (B7H4/1788), 1mg/mL

Sign In for Pricing
View Details
2-Iodobenzotrifluoride
TRC-I685630-25G 25 g

2-Iodobenzotrifluoride

Sign In for Pricing
View Details
Sprr2k Mouse Gene Knockout Kit (CRISPR)
KN516664 1 Kit

Sprr2k Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details