Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Photosystem I assembly protein Ycf4 (ycf4)

This Recombinant Photosystem I assembly protein Ycf4 (ycf4) spans the amino acid sequence from region 1-198.

Product Specifications

Product Name Alternative

Photosystem I assembly protein Ycf4

UniProt

P09362

Expression Region

1-198

Origin

Euglena gracilis

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MTLSKNENIKAKQKQINLPKILRQEIKENNKIIKWFYNIVMLLGGIGFLIVGISSYIGNN LIYFLDASEIIFFPQGITMCFYGTCGILFSINQISIILNGVGEGYNEFNKELNLMTIYRK GKQGKNSDINITYSLKDIEGIRIEIKNEYFNVKQNVFLRIKDKNDLPIIQLSNPIKISDL EKQASEIASFLNVPIKGY

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PE/iFluor® 750 Anti-human CD4 Antibody *SK3*
100421R0-AAT 25 Tests

PE/iFluor® 750 Anti-human CD4 Antibody *SK3*

Sign In for Pricing
View Details
MUSK (NM_005592) Human Recombinant Protein
TP700168 20 µg

MUSK (NM_005592) Human Recombinant Protein

Sign In for Pricing
View Details
SALL4 (C-term) Rabbit Polyclonal Antibody
AP11501PU-N 400 µL

SALL4 (C-term) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Human LOC643802 activation kit by CRISPRa
GA118705 1 Kit

Human LOC643802 activation kit by CRISPRa

Sign In for Pricing
View Details
Recombinant Angiotensinogen Antibody
RC-15467-01 50 μL

Recombinant Angiotensinogen Antibody

Sign In for Pricing
View Details
Recombinant Angiotensinogen Antibody
RC-15467-02 100 µL

Recombinant Angiotensinogen Antibody

Sign In for Pricing
View Details