Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Photosystem I assembly protein Ycf4 (ycf4)

This Recombinant Photosystem I assembly protein Ycf4 (ycf4) spans the amino acid sequence from region 1-198.

Product Specifications

Product Name Alternative

Photosystem I assembly protein Ycf4

UniProt

P09362

Expression Region

1-198

Origin

Euglena gracilis

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MTLSKNENIKAKQKQINLPKILRQEIKENNKIIKWFYNIVMLLGGIGFLIVGISSYIGNN LIYFLDASEIIFFPQGITMCFYGTCGILFSINQISIILNGVGEGYNEFNKELNLMTIYRK GKQGKNSDINITYSLKDIEGIRIEIKNEYFNVKQNVFLRIKDKNDLPIIQLSNPIKISDL EKQASEIASFLNVPIKGY

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Ccdc171 Mouse Gene Knockout Kit (CRISPR)
KN502685 1 Kit

Ccdc171 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Alkaline Phosphatase Conjugated Goat Polyclonal Antibody to Human a-1-Antitrypsin
AA-2115-1 1 mL

Alkaline Phosphatase Conjugated Goat Polyclonal Antibody to Human a-1-Antitrypsin

Sign In for Pricing
View Details
Recombinant Alpha-2-Macroglobulin Antibody
RC-15572-01 50 μL

Recombinant Alpha-2-Macroglobulin Antibody

Sign In for Pricing
View Details
Recombinant Alpha-2-Macroglobulin Antibody
RC-15572-02 100 µL

Recombinant Alpha-2-Macroglobulin Antibody

Sign In for Pricing
View Details
Recombinant Alpha-2-Macroglobulin Antibody
RC-15572-03 1 mL

Recombinant Alpha-2-Macroglobulin Antibody

Sign In for Pricing
View Details
Polystyrene AM PAL
H10022.25G 25 g

Polystyrene AM PAL

Sign In for Pricing
View Details