Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Transmembrane protein 223 (Tmem223)

This Recombinant Mouse Transmembrane protein 223 (Tmem223) spans the amino acid sequence from region 1-199.

Product Specifications

Product Name Alternative

Transmembrane protein 223

UniProt

Q9CQE2

Expression Region

1-199

Origin

Mus musculus (Mouse)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MVASVPLRNVSHLLSVLRSQNVPRYLQNGVPRDVLLFRHERGRFFAILGLFCAGQGIFWT SLAVAALSRPLSRVPAEAPNRSYQDLRSALWRYGLAVGCGTMGVLVLGAGLLYSLRSVRS VMLLAGGQQVTLTTYAPFGLGTCFTVPLNQISCMAHRGEVPAMLPLKVKGRRFYFLLDKA GHFPNTQLFDNTVGAYRSL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Prnd Mouse Gene Knockout Kit (CRISPR)
KN513941 1 Kit

Prnd Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Macrophage Inflammatory Protein 1 beta (CCL4L2) (NM_001291472) Human Tagged ORF Clone
RG235574 10 µg

Macrophage Inflammatory Protein 1 beta (CCL4L2) (NM_001291472) Human Tagged ORF Clone

Sign In for Pricing
View Details
Uncoated Porcine IL-8 (Interleukin 8) ELISA Kit
E-UNEL-P0011-01 5x 96 Tests

Uncoated Porcine IL-8 (Interleukin 8) ELISA Kit

Sign In for Pricing
View Details
Uncoated Porcine IL-8 (Interleukin 8) ELISA Kit
E-UNEL-P0011-02 15x 96 Tests

Uncoated Porcine IL-8 (Interleukin 8) ELISA Kit

Sign In for Pricing
View Details
2,3-O-Isopropylidene-L-threitol
TRC-I868890-2.5G 2.5 g

2,3-O-Isopropylidene-L-threitol

Sign In for Pricing
View Details
LINC02913 Human Gene Knockout Kit (CRISPR)
KN417042 1 Kit

LINC02913 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details