Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Bacillus subtilis Uncharacterized sugar transferase EpsL (epsL)

This Recombinant Bacillus subtilis Uncharacterized sugar transferase EpsL (epsL) spans the amino acid sequence from region 1-202.

Product Specifications

Product Name Alternative

Uncharacterized sugar transferase EpsL, EC= 2.-.-.-

UniProt

P71062

Expression Region

1-202

Origin

Bacillus subtilis (strain 168)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MILKRLFDLTAAIFLLCCTSVIILFTIAVVRLKIGSPVFFKQVRPGLHGKPFTLYKFRTM TDERDSKGNLLPDEVRLTKTGRLIRKLSIDELPQLLNVLKGDLSLVGPRPLLMDYLPLYT EKQARRHEVKPGITGWAQINGRNAISWEKKFELDVWYVDNWSFFLDLKILCLTVRKVLVS EGIQQTNHVTAERFTGSGDVSS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PROTAC Sirt2 Degrader-1
MBS5769887 Inquire

PROTAC Sirt2 Degrader-1

Sign In for Pricing
View Details
Tuft1 sgRNA CRISPR Lentivector (Rat) (Target 2)
K7169503 1.0 µg DNA

Tuft1 sgRNA CRISPR Lentivector (Rat) (Target 2)

Sign In for Pricing
View Details
β-Arrestin 1/2 (D24H9) Rabbit Monoclonal Antibody
CST 4674T 20 µL

β-Arrestin 1/2 (D24H9) Rabbit Monoclonal Antibody

Sign In for Pricing
View Details
1,5-Naphthyridine-2-carboxylic acid
ZBA85062-01 250 mg

1,5-Naphthyridine-2-carboxylic acid

Sign In for Pricing
View Details
1,5-Naphthyridine-2-carboxylic acid
ZBA85062-02 2.5 g

1,5-Naphthyridine-2-carboxylic acid

Sign In for Pricing
View Details
Platelet Derived Growth Factor Receptor alpha, extracellular domain, Recombinant Human (PDGFRA, Platelet-Derived Growth Factor Receptor, alpha polypeptide, Alpha Platelet-Derived Growth Factor Receptor precursor, CD140a, CD140A, CD140a antigen, MGC74795, PDGFR2, PDGF-R-alpha, Rhe-PDGFRA)
P4258-27A 10 µg

Platelet Derived Growth Factor Receptor alpha, extracellular domain, Recombinant Human (PDGFRA, Platelet-Derived Growth Factor Receptor, alpha polypeptide, Alpha Platelet-Derived Growth Factor Receptor precursor, CD140a, CD140A, CD140a antigen, MGC74795, PDGFR2, PDGF-R-alpha, Rhe-PDGFRA)

Sign In for Pricing
View Details