Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Acanthamoeba polyphaga mimivirus Uncharacterized protein L701 (MIMI_L701)

This Recombinant Acanthamoeba polyphaga mimivirus Uncharacterized protein L701 (MIMI_L701) spans the amino acid sequence from region 1-203.

Product Specifications

Product Name Alternative

Uncharacterized protein L701

UniProt

Q5UNV5

Expression Region

1-203

Origin

Acanthamoeba polyphaga mimivirus (APMV)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSTLSPIYSRCATQGNSCPVSTIPEAMAYADPNGTGTIYYRNSEANKAFTCNNASFGNQT NSTAYQCYNGNLPTDFRTAGSSFYENGIPKGWTKCSDENETCDPKVNSDVDILFGADGSY VYSSAKSVPCNINIFGDPKQGVKKACYWRSPLIPINHTPSTPVTPTTPSGTQTTGHKWWV YLLLFGIPLLILIFLIIFFIAKK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

EIF4G1 Antibody
orb2684860-01 50 µL

EIF4G1 Antibody

Sign In for Pricing
View Details
EIF4G1 Antibody
orb2684860-02 100 µL

EIF4G1 Antibody

Sign In for Pricing
View Details
EIF4G1 Antibody
orb2684860-03 200 µL

EIF4G1 Antibody

Sign In for Pricing
View Details
FGG Antibody Blocking peptide
orb1446703 500 µg

FGG Antibody Blocking peptide

Sign In for Pricing
View Details
CES7 Peptide - middle region
MBS3235181-01 0.1 mg

CES7 Peptide - middle region

Sign In for Pricing
View Details
CES7 Peptide - middle region
MBS3235181-02 5x 0.1 mg

CES7 Peptide - middle region

Sign In for Pricing
View Details