Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Penicillium chrysogenum Protein get1 (get1)

This Recombinant Penicillium chrysogenum Protein get1 (get1) spans the amino acid sequence from region 1-204.

Product Specifications

Product Name Alternative

Protein get1, Guided entry of tail-anchored proteins 1

UniProt

B6HS10

Expression Region

1-204

Origin

Penicillium chrysogenum (strain ATCC 28089 / DSM 1075 / Wisconsin 54-1255) (Penicillium notatum)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MLSLVLTVFFVHVAIYLVNTIGASTIDSLLWLLYLKLPTPTSRTARKQQQLKRQVLEQKH EMNSTSSQDEFAKWAKARRRHDKSMEEYEALNKTLTAQKSSFDWTVKIARWLSTNGLKIF LQFWYSKTPVFPLPEAWFPYYVEWIVSFPRAPLGSVSIHVWSNVCATTIALTAEVMGALL VQIVGQKKEQRETAPVSAEGKKAQ

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

EP300 Human Gene Knockout Kit (CRISPR)
KN223265BN 1 Kit

EP300 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
PIK3CD Human Gene Knockout Kit (CRISPR)
KN214047 1 Kit

PIK3CD Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Tissue FFPE Sections, Stomach
CS804058 5x 5 µm

Tissue FFPE Sections, Stomach

Sign In for Pricing
View Details
c Rel (REL) Rabbit Polyclonal Antibody
AP06306PU-N 100 µg

c Rel (REL) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Optitrol NAT CT/NG
NT02011 5x 1.2 mL

Optitrol NAT CT/NG

Sign In for Pricing
View Details
8-Hydroxyacyclovir
TRC-H806850-25MG 25 mg

8-Hydroxyacyclovir

Sign In for Pricing
View Details